PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009943.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 533aa    MW: 59843.3 Da    PI: 5.3134
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009943.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.32.5e-084544921854
                  HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  Aco009943.1 454 MFQNflHPYPKDSEKHLLALKSGLTRSQVSNWFINARVR 492
                  5887779******************************88 PP

2BELL62.87.4e-21326395372
         BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  +e    k+ Ll++l+ Vd++Y+q+ +q+q v+s F+ +++   +++++++A +ai+  +++L+++ia qi
  Aco009943.1 326 HEADTTKSELLTMLHLVDRKYSQCLDQIQNVVSEFNNATDSSVSNIHAQFAHHAITALYKNLRERIATQI 395
                  678889**************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.2E-15248393IPR006563POX domain
PfamPF075269.9E-27254392IPR006563POX domain
PROSITE profilePS5007111.58433496IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-26435509IPR009057Homeodomain-like
SuperFamilySSF466891.28E-15436505IPR009057Homeodomain-like
SMARTSM003893.1E-5436500IPR001356Homeobox domain
CDDcd000869.70E-11436497No hitNo description
PfamPF059203.4E-14453492IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MENDLFNASL SMSSNSHFAI EPSLSTLQVE AMDNIYMTHN GLVNYDLPFS STMGQEGSAP  60
FNGPFGNDDP REHFTGTSLP TAPVSNLFGT CLQENPSIFT LEDMRTSISS NSCKTMSSSL  120
TASVNRNFGP ENDDKLNGET DRAWSYDERI FNYFHPLYHV VGSSDSSWIF NRSDMNFSQP  180
HQSYAPSNEL SLSLGSYHPS IMTTTNISDQ SSEVSYSGVS RDSKNDGVHQ NCFNNEELSL  240
YNASSRPIHF SRLLLGSRYL HVAQQILAEV ATYALQDVNE AMDTVSGIEE EPKISFMSIT  300
NVCSDELQFS SGEAKSTEYI GAQRQHEADT TKSELLTMLH LVDRKYSQCL DQIQNVVSEF  360
NNATDSSVSN IHAQFAHHAI TALYKNLRER IATQIVLIAQ QPNTSCISET EKSFESAFIQ  420
KQWALQQLKR GDQQSWRPQR GLPEKSVSVL RAWMFQNFLH PYPKDSEKHL LALKSGLTRS  480
QVSNWFINAR VRLWKPMIEE MYSELNKSRS EEGSGGEKRV QGNTGSQRFQ MS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-15442500563Homeobox protein Meis2
3k2a_B6e-15442500563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915335.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
RefseqXP_010915334.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
RefseqXP_010915333.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
RefseqXP_010915332.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
TrEMBLM0U6341e-139M0U634_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP03720_0011e-139(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.14e-79homeobox gene 1